PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21257_a_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 137aa    MW: 15450.5 Da    PI: 9.6534
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21257_a_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.67.5e-4352128177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqve+C+ad+s+ak+yhrrhkvCe+h+ka+vv v+gl+qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk +
  Neem_21257_a_2  52 TCQVENCTADFSDAKKYHRRHKVCEFHAKAAVVRVAGLQQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKGA 128
                     6*************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375757.3E-571137IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.102.6E-3446114IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18850127IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-3951130IPR004333Transcription factor, SBP-box
PfamPF031103.4E-3353126IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MDTSKAEGKR SLKEVVEDXX XXXXXDVVGF GDDDKKKKGK RVSSGAGGSS ITCQVENCTA  60
DFSDAKKYHR RHKVCEFHAK AAVVRVAGLQ QRFCQQCSRF HELSEFDDTK RSCRRRLAGH  120
NERRRKGAAE YHGEGLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3743126284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025578.14e-60Squamosa promoter binding protein-like 3
SwissprotQ387417e-50SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A061GEC84e-60A0A061GEC8_THECC; Squamosa promoter-binding-like protein
STRINGVIT_10s0003g00050.t011e-51(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-43squamosa promoter binding protein-like 3